PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC050503.40
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MIKC_MADS
Protein Properties Length: 225aa    MW: 25998.5 Da    PI: 8.324
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC050503.40genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.64.4e-30959151
                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  krien+ nrqvt+skRrng++KKA+E+SvLCda+v+viif+s+gk++ey+s
  EcC050503.40  9 KRIENSNNRQVTYSKRRNGLIKKAKEISVLCDAQVSVIIFGSSGKMHEYCS 59
                  79***********************************************96 PP

2K-box76.38e-261011851498
         K-box  14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                   +++l++el+++kke++nLq ++Rhl+Ged++sL+++eL  Le+ Le+++  +R++K+e+l+++ +++++ e++++e + + ++k 
  EcC050503.40 101 QSNLSNELDRIKKENDNLQIQLRHLKGEDITSLNHRELIILEDTLENGVGCVRDQKDEVLMTHRRNQKQLEEDAKELHFYAQQKD 185
                   5789***************************************************************************999985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.861161IPR002100Transcription factor, MADS-box
SMARTSM004326.6E-41160IPR002100Transcription factor, MADS-box
CDDcd002651.18E-40280No hitNo description
SuperFamilySSF554551.11E-33286IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004048.2E-29323IPR002100Transcription factor, MADS-box
PfamPF003192.8E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004048.2E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004048.2E-293859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129713.991101190IPR002487Transcription factor, K-box
PfamPF014861.1E-16101178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MGRGKIEIKR IENSNNRQVT YSKRRNGLIK KAKEISVLCD AQVSVIIFGS SGKMHEYCSS  60
NTSLVDILDQ YHTQCGKRLW DAKQEVGLSY LPNIDLLVTL QSNLSNELDR IKKENDNLQI  120
QLRHLKGEDI TSLNHRELII LEDTLENGVG CVRDQKDEVL MTHRRNQKQL EEDAKELHFY  180
AQQKDMMMAE TGRAGNDGYH QRMKADFGPS TYHVQPIQPN LQRRF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D2e-17261160Myocyte-specific enhancer factor 2A
3mu6_C2e-17261160Myocyte-specific enhancer factor 2A
3mu6_B2e-17261160Myocyte-specific enhancer factor 2A
3mu6_A2e-17261160Myocyte-specific enhancer factor 2A
1egw_D3e-17261160MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C3e-17261160MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B3e-17261160MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A3e-17261160MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_S5e-17161161Myocyte-specific enhancer factor 2B
1tqe_R5e-17161161Myocyte-specific enhancer factor 2B
1tqe_Q5e-17161161Myocyte-specific enhancer factor 2B
1tqe_P5e-17161161Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001289656.11e-151floral homeotic protein GLOBOSA-like
SwissprotQ074748e-84MADS2_PETHY; Floral homeotic protein PMADS 2
TrEMBLO649341e-151O64934_EUCGR; MADS box protein
STRINGVIT_18s0001g01760.t012e-87(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.19e-78MIKC_MADS family protein